SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000667 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000667
Domain Number 1 Region: 365-540
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.13e-30
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 239-297
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.26e-16
Family PHD domain 0.0027
Further Details:      
 
Domain Number 3 Region: 1118-1165
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000072
Family PHD domain 0.018
Further Details:      
 
Domain Number 4 Region: 68-119
Classification Level Classification E-value
Superfamily ARID-like 0.000000000106
Family ARID domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000667   Gene: ENSEEUG00000000753   Transcript: ENSEEUT00000000753
Sequence length 1321
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2692:58809:109049:-1 gene:ENSEEUG00000000753 transcript:ENSEEUT00000000753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWQPPFACDVDKLHFTPRIQRLNELEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSG
DSLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMNVKIEPEET
TEARTHNLRRRMGCPTPKCENEKEMKTSLKQEPTEKKEFISESEKEKPKSRSKKTTNAVD
LYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECSKPQEAF
GFEQAARDYSLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGAD
IASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLY
VGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDL
LHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGVIDSERMDFELLPDDERQCIKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPY
KYKLRYRYTLDDLYATNEKRRAESYNEWALNVNLALEAKINKKKSLVSFKALIEESEMKK
FPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLY
ALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDISLEFDVELPQLAEM
RTRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYAAVEKAMARLQELLTVSEH
WDDKAKSLLKARPRHSLNSLATAVKEIEEIPAYLPSGVALKDSVQRARDWLQDIEALQVG
GRVPVLDTLIELVARGRSIPVHLNSLPRLELLVAEVQSWKECAANTFLTENSPYSLLEVL
CPRCDVGLLGLKKKQRKLKESLLSGKKKSTKLESLSDLERALTESKETVSAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKGPAAPMIQCELCRDAFHTSCVAVPSTS
QDLQIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTVNWQHRAQQLL
SSGNLKIIQDRGGSGLLPSRWQTSVGQTTETNKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXQVSLPEIQELYQTLLAKSPAQQSDRSSPVRTSSG
K
Download sequence
Identical sequences ENSEEUP00000000667 ENSEEUP00000000667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]