SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000674 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000674
Domain Number 1 Region: 7-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.03e-51
Family BAR domain 0.0083
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.43e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000674   Gene: ENSEEUG00000000760   Transcript: ENSEEUT00000000760
Sequence length 676
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1312:314:27856:1 gene:ENSEEUG00000000760 transcript:ENSEEUT00000000760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTRQLHRMWQLAQKAILGRTPETAEFLGEDLQQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADLDKRVKKLPLMALSTAMAESFKELDPDSSMGKALEMSCAIENQLARILAEFELTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWDALKSRLSQAAKSSGGGQGLGGGPGSHS
YTATANKVEMLKEEEEELKRKVEQCKDEYLADLYHFATKEDTYANYFIHFMEIQADYHRK
SLSSLDTALAELRENHSQADPSPSMTATPFSRVYGVSLGSHLQELGRDIALPIEACVVML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLQEFCSDPHAVAGALKSYLRELPEPLM
TFELYDDWMQAASLKDPGPRLEALQEVCGRLPRENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSANTLFPGDISFNVSGL
FSALGPQDKGSETSEEPLAVDATPTLCPSAAVKERTEPEASPRPASPKVNRSPPEPVAPA
EDTARRTKRPAPARPTMPPPQVSGPRSSPPAPPQPPSSGSPGTPRALPRRLVGTSLAPSV
PLPLPPMPPQPARRQNWRSAASPGPESPSHTSLLGPGQGDLEGTTEGRCPEGGGGAPAPP
IVPPQPRPRSLASETD
Download sequence
Identical sequences ENSEEUP00000000674 ENSEEUP00000000674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]