SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000965 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000965
Domain Number 1 Region: 951-1078,1110-1311
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-64
Family p120GAP domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 1532-1629
Classification Level Classification E-value
Superfamily RGC domain-like 1.44e-30
Family RGC domain 0.000012
Further Details:      
 
Domain Number 3 Region: 93-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.78e-20
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 
Domain Number 4 Region: 729-813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000433
Family Nucleotide and nucleoside kinases 0.047
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000965
Domain Number - Region: 666-695
Classification Level Classification E-value
Superfamily WW domain 0.000117
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000965   Gene: ENSEEUG00000001066   Transcript: ENSEEUT00000001079
Sequence length 1629
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7811:357:74361:-1 gene:ENSEEUG00000001066 transcript:ENSEEUT00000001079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGRGAVPGRAVFTAEEMDEQRRQNVAYQYLCRLEEAKRXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATGLHFRHTDNINFWLSAIAHIGLPSTFF
PETTDIYDKKNMPRVVYCIHALSLFLFRLGVAPQIHNLYGKVKFTAEELSNMASELAKYG
LQLPAFSKIGGILANELSMDEAAVHAAVLAINEAVERGIVEDTLAALQNPNALLENLREP
LAAIYQKLLALAKTEKTANARNRENGDSQDIYDSFLTQAEIQGNINHVNVHGALEVIDEA
LERQNPEALLEALQDPALALQGIRHDFANWYLEQLNLDREQKAQELGLVELLEKEEVQAG
VAAANIKGNEEQAMLRAVQRINRAIQRGLAADTVQELACPEAQLPPVYPFAAPLYQQGLT
VLQQQRGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTGDPGAVLWLEEIRQEVLRANQDT
DIAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPHCADSYQRVLESDMTKKQH
PGDTALWVRHDLKDGTTYYFHLHTFQGTWEHPRSCHLNTSHLTREEIQSAVTRVTAAHDR
RQLWKANVGFVIWLQARFRGFLVRQQFAKRFHFLRTWSPAVIRIQAYWRGYRQRRSYQER
LQYLKSQVDAVIKIQAWTRMWAARRRYRRRLGYFQKNVSSVVKIQAFFRARKARDDYWTL
VHATHPPLSVVRRFVHLLNQSQQDFLAEAELLKLQEEKVRKIRCNQQLEQXXXXXXXXXX
XXXXXXXXXXEVVSHCKKLTKKNKEQLSDMMVLDKQKGLKALSKEKRQKLEAYQHLFYLL
QTQPIYLAKLIFQMPQNKTTKFMESVIFSLYNYASNHREAYLLLQLFKTALQEEVKSKVE
RPQDMVTGNPTVVRLVVKFYRNGRGQSALQEILGRVVQDVLEDKQLSIHTDPVHLYKSWI
NQTEAQTGQRSHLPYDVTPEQALSHPEVQRRLDIALRKLLTVTERFLGAIVSSVDQIPYG
MRYVAKVLKTALVEKFPDASEDEIYKASVVGNLLYYRFLNPAVVAPDAFDIVALSAGGAL
TAPQRHALGAVAQLLQQAATGKAFSGESCHLRVLNDYLEETHVKFRRFICRACQVPEPEE
RFAMDEYSDMVAVSKPVVYVTVGELVNTHRLLLEHQDWIAPAHQDPLHQLLEPRELPTVP
DLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKQMLADIMQFHPG
DSLEEILSLSASREQEMAHKRLMCRRQACEAQTPEPLRRHRSLTTHALLPLVEKQRGILR
SMSRLEXXXXXXXXXXXXXXXXXXXXDIRSQHRHRQRRKAELLKLWATLQGLSAKATFYE
EQGDYYSQYLRACLDHLAPSSRISKKGKKQPSLHYTAAQLLEKGVLVEIEDLPTSHFRNV
IFDIIPGDEAGKFEVNAKFLGVDMEHFQIHYQDLLQLQYEGVAIMKLFNKAKVNVNLLIF
LLNKKFLRK
Download sequence
Identical sequences ENSEEUP00000000965 ENSEEUP00000000965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]