SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001063 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001063
Domain Number 1 Region: 978-1095
Classification Level Classification E-value
Superfamily Bet v1-like 1e-36
Family STAR domain 0.00000073
Further Details:      
 
Domain Number 2 Region: 48-122
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-32
Family Variant SAM domain 0.0000424
Further Details:      
 
Domain Number 3 Region: 757-865
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000157
Family BCR-homology GTPase activation domain (BH-domain) 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001063
Domain Number - Region: 654-688
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0235
Family BCR-homology GTPase activation domain (BH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001063   Gene: ENSEEUG00000001180   Transcript: ENSEEUT00000001182
Sequence length 1107
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3692:3750:103818:-1 gene:ENSEEUG00000001180 transcript:ENSEEUT00000001182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSQGPRTPASGCYYLNSMTPEGQEMYLRFDQTARRSPYRMSRILARHQLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLYRRLNTLNKCASMK
LDVNFQRKKEEEELCSNIWAFQRTHHCLSPIHVLHTLFPGGDRSRPSGNIMRNKTSRKSI
YTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTGGLVISGPVLPVEPESFKAMQCIQI
PNGDVQNLSPAEDKRRLECSSKWSSESSQSENSSSGLSITGQKEQRCQVPNKRGGMYLED
LDVLAGTALQDPGDQNHSHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDASNGVNW
RTGSISLSRQQGPGTREPKLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKEDLFPHL
DDILHHVNGLREVVDDWSKNILPELQTQDTLVAEPGLCPFPSPNQITFDFEGNSVSEGRT
TPSDVERDGTSLNESEATGVRERRDSGVGASLTRPNXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVPKFMKRMKVPDYKDKTVFGVPLI
VHVQRTGQPLPQSIQQALRYLRSNCLDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPKEQRLQAAQAAILLLADESREVL
QTLLCFLHDVVSLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATGKPDQKD
LNENLAAAQGLAHMIMECNRLFEVPLEMVAQSHSSYVEAEVHAPTLEELGMQLEESGATF
HTYLEQLIQGLQKEAKEKFKGWVSCSSTDNTELAFKKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKIVENLDKQTEIYQYVLNSMAPHPSRDFVVLRTWKTDLPKGM
CTLVSLSVEHEDAQLMGGVRAVVLDSQYLIEPCGSGKSRLTHICRIDLKGHSPEWYSKGF
GHLCAAEVARIRNSFQPLIAEGPETKI
Download sequence
Identical sequences ENSEEUP00000001063 ENSEEUP00000001063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]