SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001117 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001117
Domain Number 1 Region: 27-102
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.31e-16
Family PHD domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001117   Gene: ENSEEUG00000001251   Transcript: ENSEEUT00000001246
Sequence length 300
Comment pep:novel scaffold:HEDGEHOG:scaffold_205497:199:9647:1 gene:ENSEEUG00000001251 transcript:ENSEEUT00000001246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFRCDCGNSKFKNLECKLFPDKGKTNPGNKYNDNFFGLYCICKRPYPDPEDEVPDEMIQC
VVCEDWFHGRHLGAAPPESGDFQEMVCPACMRRCSFLWVYATHLAVTRVAAEEDSLVLNV
AGPAGPEVAEPEDGAQDSTLRENVVPHGKDTVRDAAAEQMSEPCPGSSSEPVFQTPFQNQ
ECGGAQPRAGCRLEELRAQRYVKKDAATYWPPNWRSKLCACKACLEMYGELDVVFLIAER
DTVLAYENKGKVGQAAGRRDPLMDTLNSMDRVQQVELICEYNDLKTELKDYLRRFADEGT
Download sequence
Identical sequences ENSEEUP00000001117 ENSEEUP00000001117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]