SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001137 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001137
Domain Number 1 Region: 365-395
Classification Level Classification E-value
Superfamily F-box domain 0.000000124
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 23-94
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000437
Family variant PHD-like domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001137   Gene: ENSEEUG00000001272   Transcript: ENSEEUT00000001268
Sequence length 504
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1282:3046:23058:1 gene:ENSEEUG00000001272 transcript:ENSEEUT00000001268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKFGGPGRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFALSLMECTICN
EIVHPGCLKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGS
GWKLTEEPPLLPPQPRRKGPLPAGTPSEDMPGPPKRKEREAGNEPPTPRKKVKGGRERHL
KKVGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPELPPENWEKPKPPLASAEGPAAP
APSPQREKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPAR
GSSGEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAA
GSDHPLPRAAWLRVFQHLGPRELCVCMRVCRTWSRXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDSQLRELLLPPPDTNP
Download sequence
Identical sequences ENSEEUP00000001137 ENSEEUP00000001137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]