SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001176 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001176
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily Sema domain 2.62e-41
Family Sema domain 0.0062
Further Details:      
 
Domain Number 2 Region: 1434-1585
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.77e-23
Family p120GAP domain-like 0.041
Further Details:      
 
Domain Number 3 Region: 668-756
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000267
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 4 Region: 755-799,837-890
Classification Level Classification E-value
Superfamily E set domains 0.0000000172
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 5 Region: 212-238
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000235
Family Plexin repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001176
Domain Number - Region: 891-979
Classification Level Classification E-value
Superfamily E set domains 0.00202
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001176   Gene: ENSEEUG00000001301   Transcript: ENSEEUT00000001311
Sequence length 1653
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1530:37305:51203:1 gene:ENSEEUG00000001301 transcript:ENSEEUT00000001311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYHSYVARNNLDDINLYSYVEMPLLCQGQGLIQAAFLTPGALLGAFSAGTRGTQAALCAF
PLAQLAASMERARRLCYTAAGRGPDGQEEAAVEYGVTSCCVTLPAXSPESYPCGEEHTPS
PIAGRQPLEAGPLLRLSQPISAVAALQADGLTIAFLGDTQGRLHKVFLNGSQGQVYSSQQ
VGPPGATVSPDLLLDASSSHLYVLTAHQVDRVPVAACPQFSDCASCLQARDPLCGWCVXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLSVPQLPILAAD
EYFHCALGDYDSLANVEGAHVGCVTPPQDQLPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDPTLLSLSPQRGPQAGGTQLTIHGRHLQTGHNISAFVGSQPCPIQEPVCPEV
IVCRTRPQAAPGEAVVRVVFGQAQRTLRAKPFHYTANPQIMAAEPNVGFRGGGRLIRVRG
TGLDVVRRPQLSVLLEASAKVQAAATQPQAPPPGRSCRGPAAPSQACVQLEGGQLQCSSA
CSINSSSLLLCWSPAVPDGAHPQRVFFTLDNVQVDFSSASGGQDFLYQPNPRLNPLSPEG
PNRPYRLKPGNVLDVEGEGLSLGISKEEVRVHIGTGECLVKTLTLTHLYCEPPLHAPPPT
NGSGSGLPQFVVQMGNVRLALGPVQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSVHALD
LEWRSGLAGHLTLSNEDLTSVTQGHWKRLNTLQHYKVTDGATVGLISQLHNGGAIAQSLH
ISCPVENIPMLEDSEEGGVRLWHLVKAPEEPEGTKACSSLRERSERARAKAIPEIYLTRL
LSMKGTLQKFVDDTFQAILSVNRPVPIAVKYLFDFLDELAERHSIDDPETLHIWKTNSLL
LRFWVNTLKNPRLIFDVRVSDNVDAVLGVIAQTFIDSCTVSEHKVGRDSPVNKLLYAREI
PRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLEALQELYNHIHRYYDQI
ISALEEDPIGQKMQLACRLQQTAALVENKVTDL
Download sequence
Identical sequences ENSEEUP00000001176 ENSEEUP00000001176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]