SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001218 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001218
Domain Number 1 Region: 176-332,422-682
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.92e-50
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 785-905
Classification Level Classification E-value
Superfamily PKD domain 3.4e-18
Family PKD domain 0.00024
Further Details:      
 
Domain Number 3 Region: 919-987
Classification Level Classification E-value
Superfamily PKD domain 0.0000405
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001218   Gene: ENSEEUG00000001349   Transcript: ENSEEUT00000001354
Sequence length 1212
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5541:51139:628142:1 gene:ENSEEUG00000001349 transcript:ENSEEUT00000001354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAARTECPAGWPGAPLVGTGFLPLSTDLAGPEITWGAAGGPGSPAAQARPSALPPLSPR
ALSSQWPVEMATARGHRQGPERLLQPRGSEKPGGALHPWAAGARWEQGVLTPGKPGGARR
SRRAEAPSALERGDTLAAALAEDSKANRPVARGLREEGKASRAAGPVAEELRLPSTSFAL
TGDSAHNQAMVHWSGHNSSVILILTKLYDFHLGSVTESSLWRSTDYGTTYEKLNDKVGLK
TVLSYLYVNPTNKRKIMLLSDPEMESSILISSDEGATYQKYRLTFYIQSLLFHPKQEDWV
LAYSLDQKLYSSMDFGRRWQLMHERITPNRFYWSVAGLDKEADLVHMEVRTTDGYAHYLT
CRIQECAETTRTGPFVRSIDISSLVVQDEYIFIQVTTGGRASYYVSYRREAFAQIKLPKY
SLPKDMHIISTDGNQVFAAVQEWNQNDTYNLYISDTRGIYFTLAMENIKSNRGLMGNVII
ELYEVAGIKGIFLANKKVDDQVKTYITYNKGRDWRLLQAPDVDLRGSPVHCLLPFCSLHL
HLQISENPYSSGRISSKETAPGLVVATGNIGSELSYTDIGVFISSDGGNTWRQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVSFDEGHSWDKYSFTSVPLFVDGALVEAGVETQIMT
VFGHFSLRSEWQLVKVDYKSIFGRRCTKEDYQTWHLLNQGEPCVMGERKIFKKRKPGAQC
ALGHDSSGTVVSEPCVCADWDFECDYGYERHGESQCVPAFWYNPASPSKDCSLGQSYLNS
TGYRRIVSNNCTDGLREKYTAKAQLCPGKAPRGLHVVTTDGRLVAEQGHNATFIVLMEEG
DLQRTNIQLDFGDGIAVSYANFSPIEEGIKHVYKSAGIFQVTAYAENNLGSDTAVLFLHV
VCPVEHVHLRVPFVAIRNKEVNISAIVWPSQLGTLTYFWWFGNSTKPLITLDSSISFTFL
AEGINTITVQVAAGNALIQDTKDIAVHEYFQSQLLSFSPNLDYHNPDIPEWRQDIGNVIK
RALVKVTSVAEDQILVAVFPGLPTSAELFILPPKNLTERRKGNEGDLEEIVELLFSALNQ
NLVQFELKPGVQVTVYVTQLTLAPLVDSSTGHSSSAMLMLLSVVFVGLAVFLIYKFKRKI
PWINIYAQVQHDKEQEMIGSVSQSENAPKITLSDFTEPEELLDKELDPRVIGGIATIANS
ESTKEIPNCTSV
Download sequence
Identical sequences ENSEEUP00000001218 ENSEEUP00000001218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]