SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001457 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001457
Domain Number 1 Region: 427-731
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-87
Family p120GAP domain-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 298-408
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000432
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 3 Region: 225-296
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000252
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001457
Domain Number - Region: 1080-1234
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001457   Gene: ENSEEUG00000001598   Transcript: ENSEEUT00000001606
Sequence length 1262
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_792:23542:165633:1 gene:ENSEEUG00000001598 transcript:ENSEEUT00000001606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPGLEADSPLPPEELDTAVPVIGATGGMLDRILLESVCXXXXXXXXXXVKGPPTHHLSC
GQSPYTDTTTWERKYCILTDSQLVLLNKEKEIPLEGQEQQTDSTKGRCLRRTVSVPSEGQ
FPEYPPEGTTKLEVPAERSPRRRSISGTSTSEKPNCMDTANTSPFKVPGFFSKRLKGSIK
RTKSQSKLDRNTSFRLPSLRNTDDRSRGLPKLKESRSHESLLSPCSAVECLDLGRGEPVS
VKPLHSSILGQDFCFEVTYLSGSKCFSCNSASERDKWMENLRRTVQPNKDNCRRAENVLR
LWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFYSLPSIHSITVHIY
KDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPVSTPTPNKGKTGGPSIRIKSRFQT
ITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDL
VMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYRHDALGEFIKALYESDENCEVDP
SKCSSSELIDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERL
ISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVIQNLANFAKFGNKEEYMAF
MNDFLEHEWGGMKRFLLEISNPDTISNTPGFDGYIDLGRELSVLHSLLWEVVSQLDKGEN
SFLQATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSSPNVSGSLSSGLQKIFED
PTDSDKHKLKSPSQDNTPRNCRGKTLLLLQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTQSTPQSAPQVRRPLHPALNQ
PLSFQNPVYHLNNPIPAMPKASVDSSLENLSTASSRSQSNSEDFKLSGPSNSSMEDFTKR
STQSEDFSRRHTVPDRHIPLVLPRQNSTGQAQIRKMDQTGLGARAKAPPSLPHSASLRST
ESMSVVSAALVAEPVQNGSRSRQQSSSSRESPVPKVRAIQRQQTQQVQSPVDSATMSPVE
RTAAWVLNNGQYEEDVEETEQNPDEAKHAEKYEQEITKLKDRLRVSSRRLEEYERRLLVQ
EQQMQKLLLEYKARLEDSEERLRRQQEEKDSQMKSIISRLMAVEEELKKDHAEMQAVIDA
KQKIIDAQEKRIMSLDSANTRLMSALTQVKERYSMQVRNGISPTNPTKLSITENGEFKNS
SC
Download sequence
Identical sequences ENSEEUP00000001457 ENSEEUP00000001457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]