SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001509 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001509
Domain Number 1 Region: 326-508
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000527
Further Details:      
 
Domain Number 2 Region: 119-202
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000051
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001509
Domain Number - Region: 33-60
Classification Level Classification E-value
Superfamily WW domain 0.00131
Family WW domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001509   Gene: ENSEEUG00000001655   Transcript: ENSEEUT00000001660
Sequence length 510
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7949:2735:65338:-1 gene:ENSEEUG00000001655 transcript:ENSEEUT00000001660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTPETDYPELPTSYPEEDYSPVGSYNEADPCSPLATPPGWSCHTDSDGKIFYTNDVSGE
QVPIPAPRSIRKSSGDSETPTQVTQPEEKVIPASEWGKVGSWEETSSSAAAVARIKTLDK
AGVLNRTKTVDKGKRLRKKHWSASWTVLEGGVLTFFKDSKSSATGGLRQPSKLSTPEYTV
ELRGASLAWAPKDKSSKKNVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTESL
EEEKENSPVDYGSRERLGSWWEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXAVLCERERSPVPRFVQQCIRTVEARGLDIDGLYRISGNLA
TIQKLRYKVDHDERLDLDDGRWEDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQD
PAQRIRCVRDLVRSLPAPNHDTLRLLFQHLCRVIEHGEENRMSMQSVSIVFGPTLLRPET
EEASMPMTMVFQNQVVELILQQCSDIFRPH
Download sequence
Identical sequences ENSEEUP00000001509 ENSEEUP00000001509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]