SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001518 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001518
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily Sema domain 0.000000000484
Family Sema domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001518
Domain Number - Region: 312-398
Classification Level Classification E-value
Superfamily E set domains 0.00308
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.083
Further Details:      
 
Domain Number - Region: 1061-1106
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00455
Family p120GAP domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001518   Gene: ENSEEUG00000001661   Transcript: ENSEEUT00000001669
Sequence length 1216
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3983:13374:266605:1 gene:ENSEEUG00000001661 transcript:ENSEEUT00000001669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNGDRPERVEPIASATLIHSDLRSGYGTVVMNRTVLFLGTEDGQLLKVILGENLTSNCPE
VIYEIKEETPVFYKLVPHPEKNIYIYLTAGKEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCTFKEDCIHPQNWLDISSGAKACPQIDLFRRSKDKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSVIHVTFSFGSWNLSKRFDFTNCSSLRE
CPACIGTGCAWCQSETKCIHPFTACEPSDYKRSQELCPAATEKQAPAKTPGGGRSKESRG
NRTNQDLQVFSVKSIEPRKISTLGKSNVIVTGANFTQASHITMVLKGTSTCDQDVIQVSH
VLNDTHMKFSLPLSRKEMKAVCIQFDGGDCSSAGALSYIALPRCSLIFPATTWIXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYCVETYCRFPAPSWKSSKAHTNVTVSLRVQETY
LDCGNLQYLEDPRFTGYRVDPEVDTELEVKIQKENDNFNISKKDIEITLFHGENRQLNCS
FENITRNQDLTTIFCKIKGITTANSIATSSKKVRVRLGNLELFVEQESVPSTWYFLIVLP
VLLVVVIFAAVVVTRHKSKELNRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGT
VPFLDYKHFALRTFFPESGGFTHIFTEDTHNRDASDKNESLTALDALICNKSFLVTVIHT
LEKQKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQ
VPEFSTVALNVVFEKIPENESADVCRSISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQ
LNEIGLELQVGTRQKELLDIDGSSVILEDGVTKLNTLGHYEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPLRFWVNILKNPQFVFDI
KKTPHIDGCLSVIAQAFMDAFSLTEQQLGKXXXXXXXXXXXXXXXXXXXXKSYYKAIRDQ
PPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQL
LHVKVLFDEKKKCKWM
Download sequence
Identical sequences ENSEEUP00000001518 ENSEEUP00000001518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]