SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001635 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001635
Domain Number 1 Region: 554-630,1244-1395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.54e-31
Family Tandem AAA-ATPase domain 0.0016
Further Details:      
 
Domain Number 2 Region: 459-521,549-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.3e-17
Family Tandem AAA-ATPase domain 0.0049
Further Details:      
 
Domain Number 3 Region: 396-460
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000487
Family PHD domain 0.0073
Further Details:      
 
Domain Number 4 Region: 1174-1227
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000436
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001635
Domain Number - Region: 648-747
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000903
Family Tandem AAA-ATPase domain 0.069
Further Details:      
 
Domain Number - Region: 760-822
Classification Level Classification E-value
Superfamily TPR-like 0.0148
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number - Region: 8-62
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0328
Family Tandem AAA-ATPase domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001635   Gene: ENSEEUG00000001784   Transcript: ENSEEUT00000001795
Sequence length 1425
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4884:38868:177124:-1 gene:ENSEEUG00000001784 transcript:ENSEEUT00000001795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEEDDEDSENEPEGQDIDELYHFVKQTHQQETYSIPVDVQHPALNPVLRPYQREAVQWM
LQRERFSGGPPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKVVNYFIPSCHSEGKVKNKETQNMEFEPKE
KVHCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFGSPRKIQKESRRSGNKDTDSEYLPSNT
SDDDDDDPYYYYCKARRYRSKMRKKLVPFTKKGGSQPDTNLSSQNHCPATSDSGVTDVTL
SSSTNVFNATPKHEAEDQTESLDPTGSGTPSPKSVRPSEDRFECICGELNQLDCKARVRC
LKCHLWQHAKCVNYEEKNLKVKPFYCPHCLVAMEPVSTRATLIISPSSICHQWVDEINRH
VSSSSLRVLYQGVKKDGFLQPHFLVEQDIGIITYDVPRSELNYVDIPHRNSEGGRRXXXX
XXXXXXXXPLVAVEWWRICLDEAPELLECPTVKAAEMAQRLSGINRWCISGTPVQRGLED
LFGLVVFLGIEPYCVKHWWVRLLYHPYCKKNPQPLYSFIAKILWRSAKKEVIDQIQIPPQ
TEEVHWLHFSPVERHFYHRQHEVCCQDAVVKLRKISDWALKLSSLDRRTVTSILYPLLRL
RQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCGTECEEAHRQLVCALNGLAGIHIIK
GEYALAAELYREVLRSSEEHKARLKTDSLQRLHATHNLMELLVAKHPGIPPTLRDGRLEE
EARQLREHYMSKCNTEVAEAQQALQPVQQTIRELQRKVHPNSPWWLNVIHRAIDFSVEEE
LVQRVRNEITCNYKQQIDKLSMSEKFRDCRGLQFLLTTQMEELSKFQKLVRDAVKNLEGP
PSRSVIQSATACHLRPARLPLNCLVFYXXXXXXXXXXXXXXXXTVKGQTAIFEEMIEDEE
GLVDDRIPTTSRGLWAVSETERSLKALLSFARSHRFDAEFIDQGSASMDLFEAWKKEYKL
LHEYWMTLRNRVSAVDELAMATERLRVRHPKEPKPNPPVLYIIEPHEVEQNRVKLLNDKT
VATSQLQKKLGQLLYLNNLEKSQDKTSGGINPEPCPICARQLGKQWAVLTCGHCFCNECI
SIIIEQYSVGSHKSSIRCAICRQTTSHKEISYVFTSEKASQEEDIPVKGSHSTKVEAVVR
TLMRIQLRDPGAKALVFSTWQDVLDIISKALTENNMEFAQIGRVKTFQENLSAFKHDPDI
NILLLPLHTGSNGLTIIEATHVLLVEPILNPAHELQAIGRVHRIGQTXXXXXHRFLIKAT
IEEGQTMLKTAERSLTNSSVKHSEASVLTVADLADLFTKETEELE
Download sequence
Identical sequences ENSEEUP00000001635 ENSEEUP00000001635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]