SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001660 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001660
Domain Number 1 Region: 713-766
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000797
Family PHD domain 0.0039
Further Details:      
 
Domain Number 2 Region: 861-904
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000377
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001660
Domain Number - Region: 427-462
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0259
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001660   Gene: ENSEEUG00000001816   Transcript: ENSEEUT00000001823
Sequence length 931
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1886:480:156992:1 gene:ENSEEUG00000001816 transcript:ENSEEUT00000001823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEGSGNGSEDPSKDSGEGSCSD
SEENILEEELNEDIKVKEEQLKNSVEEEILSSDKQLIKMEKKEEEENGERPRKRKEKEKE
KEKEKEKITVSDNVAASAAANTPATSPPAVSTPPSVPTTATTTEEQVSEPKKWNLRRNRP
LLDFVSMEELNDMDDYDSEDDNDWRPTVVKRKGRSASQKDGSDGDNEDDEDEGSGSDEDE
NDEGNDEDHSSPASEGSKKEKSKVLSRNSADDEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYGVDGESDSIMSSASENSTEP
WFCDACKCGVTPSCELCPNQDGIFKETDAXXWVHIVCALYVPGVAFGDIDKLRPVTLTEM
NYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDIADPF
FAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQXXXXXXXXQYRKAELAR
STRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGRRKHKQ
PALTADFVNYYFERNMRMIQIQENMAEQKTIKDKLENEQEKLHVEYNKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXKLNIPAILRAPKERKPSKKEGGTQKTSILPTLLIFCGICK
KNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMETDMAMET
LPDGTKRSRRQIKEPVKFVPQDMPPEPKKIPIRNTXXXXXXXXXXXXXXXXXRQRKQRKS
VLQKKPKTADLQTECATSMRNSGNENLICDECRLCYHFGCLDPPLKKSPKQTGYGWICQE
CDSSSSKEDENEAERKIISQELSMEQKNPKK
Download sequence
Identical sequences ENSEEUP00000001660 ENSEEUP00000001660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]