SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002171 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002171
Domain Number 1 Region: 288-490
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-41
Family Reprolysin-like 0.001
Further Details:      
 
Domain Number 2 Region: 580-637
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.7e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1118-1171
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000615
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 988-1043
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000114
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 1049-1109
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000105
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 920-985
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000126
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002171
Domain Number - Region: 874-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000222
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002171   Gene: ENSEEUG00000002366   Transcript: ENSEEUT00000002376
Sequence length 1215
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4452:39001:164199:-1 gene:ENSEEUG00000002366 transcript:ENSEEUT00000002376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERALPAAGSAPRGGPAGLGRVAKALQLCCLCYSLVAAALASDNSXXXXXXXXXYIFVTP
VQVDSGGAYITHDILHSSSRKKRSANSSLHYRFSAFGQEIHLDLKPSAILSHHFMVQVLG
KDGASETLDPNPEVQQCFYQGFVRNDSFSSVAVSTCAGLSGLIKTQKNAFLISPLPQLLA
LKHNYSSPTGNHPHVLYKRTAEAKVQQYQGYPGSSQNDPGSPSTHTFSASRHQEQEPHPP
RFQKQHFCGRRKKYAPKSPTQDTYLMFDEYGTLRRPRRASGENQKGLNVETLVVADKKMV
EKHGKENVTTYILTVMNMVSSLFKDGTIGSDINIIVVSLILLEQDPVGLLINHHADQSLN
SFCQWQSALIGKNGKRHDHAILLTGLDICSWKDEPCDTLGFAPISGMCSKYRSCTINEDT
GLXXXXXXXXXXXXXFGMVHDGEGNPCGKVEGSIMSPTLMGNNGLFSWSSCSRQDLQKFL
STPQAGCLVDEPKQTGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCTFDFVKDICKSLWC
HRMGHRCETKYMPAAEGTECGLSKWCRQGQCVQFGEHGPQPVDGQWSTWSSWSECSRTCG
GGVKYQERDCNNPKPRYGGKFCPGSSRNYQLCNTHPCNKSSLDFRAQQCAEHNSKPFRGW
FYKWEPYTKVQEEDQCKLYCKAENFEFFFAMSGKVKDGTPCSPNKHDVCIDGICKPVGCD
HKLGSKAVLDSCGICKGDNSTCKIYKGLYLNQHKKNGYYPVVIIPAGAQGIEIQELQIST
SYLAVRNLSQKYYLMGDWSISWPGEFPFAGTTFQYQRTFHRPERLHAPGPTNETLVFEIL
MLGRNPGIAWKYTLPKGMNGTLLASKRHTHVWKTVQSGCSVSCGGGVIITKAICFQDQTI
QVNSSFCNVRTKPATSPKICNTFSCPAYWKPGEWSMCSKSCAGGQQSRKIQCVQKKSFQK
EEPVLHSLCPVSTPTQIRVCSNHACPPTWSLGPWSQCSKTCGRGVRKREVLCKSSDTGGN
VSESLCSSTLKPASQEGCVLGRCPKNNRLQWVVSSWSECSVTCGSGIRRRELQCSEDLQG
KLITFPERRCRNIKKPNPDLEETCNQGLCPTHPVYSTPARWYASPWQQCTVTCGGGVQTR
TVYCLQQGRPSLYCRLEEKPPVLQACNTNFCLALEKREDPSCVDFFSWCYLAPQHGVCNH
KFYGKQCCKSCTRKS
Download sequence
Identical sequences ENSEEUP00000002171 ENSEEUP00000002171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]