SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002285 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002285
Domain Number 1 Region: 1061-1273
Classification Level Classification E-value
Superfamily SET domain 4.06e-71
Family Histone lysine methyltransferases 0.0013
Further Details:      
 
Domain Number 2 Region: 962-1076
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-22
Family PWWP domain 0.00000937
Further Details:      
 
Domain Number 3 Region: 1291-1364
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000532
Family PHD domain 0.0036
Further Details:      
 
Domain Number 4 Region: 915-958
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000175
Family PHD domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002285
Domain Number - Region: 748-804
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00952
Family PHD domain 0.028
Further Details:      
 
Domain Number - Region: 716-753
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00975
Family PHD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002285   Gene: ENSEEUG00000002476   Transcript: ENSEEUT00000002500
Sequence length 1435
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4966:54104:185941:-1 gene:ENSEEUG00000002476 transcript:ENSEEUT00000002500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIVEDGGQTPYEATLQQGFPYP
PTTEDLPPLTNGYPPSVSMYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QANEHTKTKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERIDTVSENPRE
DPVIKEETPQPILSSGQLTVSAGVMFQVGDLVWAKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIGNKTEISVRGQDR
LVISSPNQRNEKTTQNVSSPEATSGSAGSVEKKQQRRSVRTRSESEKSTEVVPKKKIKKE
QVETIPQATVKAGLQKGASEISDSCKPLKKRSRASTDVEMNSSAYRDTSDSDSRGLSDLQ
VGFGKQVDSPSATADADISDVQSVDSSFSRRGGMSKKDIVCQXXXXXXXXXXXXXGCCKY
FHMECLRLNPYMGDGRFICTECKTGQHPCFSCKEAGTDVKRCSVACGKFYHEACVRKFPT
AIFESKGFRCPQHCCSACCMEKDIHKASKGRMIRCLRCPVAYHSGDACIAAGSLFVSSCI
LICSNHSKRSSSSSAAINVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAELMK
LPMIPSSSASKKKYEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHYKQV
WVLGNYWQXXWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVEG
DKNFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANKVI
GKVQIHVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFTKR
LYPDAEIIKTERRGWGLRTKRTIKKGEFVNEYVGELIDEEECRLRIKRANENSVTNFYML
TVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFNYN
LDCLGNGRTVCHCGAENCSGFLGVRPKSACASTVEEKTKNAKLKQKRRKIKAEPKQMHED
YCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCNECSSAAVSFCEFCP
RSFCKDHDKGALVPSALEGRLCCSEHDPTAPVSPEYWSKIKCKLESQDHGEEMKE
Download sequence
Identical sequences ENSEEUP00000002285 ENSEEUP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]