SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002527 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002527
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002527   Gene: ENSEEUG00000002745   Transcript: ENSEEUT00000002760
Sequence length 915
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2931:147640:219137:-1 gene:ENSEEUG00000002745 transcript:ENSEEUT00000002760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDDNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDLKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSITEQVNEISEEEEE
DEKLEHIEELPEEGAEKSNDMPEVVQLRMTENILEPNSVTASTXXXXXXXXXXXXXXXIL
ERTIRAAVEQHLFDLQTSIDHDLNLQQQSLVCNNEAGSINCVGEEANNQVDIADDITNAS
ESNRDCSEPVTSTNLDNEVMQQDFIFEDEENIQXXXXXXXXXXXXXXXXXXXXXXEEYWS
FDSDKLSHLILDSSSKICDLNANTESEMPEGQNVGGQGETTCIQIPHLDLKNISDGDKWE
EPFPAFKSWQEDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQSQRFLHDPETL
DSSSKALSFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKISQFEEQFERENSKPSYSDI
AANPKVLKWMTELTKLRKQIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMTKDHLVEEKTSLQKSLLYYE
SQHGRPVTREERHIVKPLYDRYRLVKQMLTRASITPVLGSPSTKRRGQMLQPIIEGETAH
FFEEIKEEEEDGVSLSSELTDLLKTAVQAQSSLENLESDVEENQEKLALDLRLSSTRAAS
MLELLEQLWKARAEKKKLRKTIREFEEAFYQQNGGNAQKEDRVPVLEEYREYKKIKAKLR
LLEVLISKQDSSKSI
Download sequence
Identical sequences ENSEEUP00000002527 ENSEEUP00000002527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]