SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002536 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002536
Domain Number 1 Region: 35-119
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.21e-45
Family variant PHD-like domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 111-192
Classification Level Classification E-value
Superfamily EF-hand 0.00000517
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002536   Gene: ENSEEUG00000002777   Transcript: ENSEEUT00000002770
Sequence length 313
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3044:3:25106:1 gene:ENSEEUG00000002777 transcript:ENSEEUT00000002770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRDGRVPEDFDRTSRFTPPLIRPTRKLDDDKPLDICLEPRESVINDEMCDVCEVWTAESL
FPCRVCTRVFHDGCLRRMGYIQGDSAAEVIETAHTETGWSCHYCDNLNLLLTEEEMYSLM
ETFQQCKVIPDCSLTLEDFVRYRHQAAKRGDSDRALSEEQEEQAARQFAALDPERRGHVE
WPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARATFLAQGNRSTISEAECRRAQHSWF
CKRLPEAPSCSVSISHVAPIADSSPEGQGQDKALMPTEQESRSVDWPTFLQENIIYILAA
RPNSAAIHLKPPG
Download sequence
Identical sequences ENSEEUP00000002536 ENSEEUP00000002536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]