SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002731 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002731
Domain Number 1 Region: 839-919
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-18
Family PHD domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002731   Gene: ENSEEUG00000002987   Transcript: ENSEEUT00000002976
Sequence length 930
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6389:5231:149422:1 gene:ENSEEUG00000002987 transcript:ENSEEUT00000002976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPESEELLPPMKRPRILSMKGDALDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDL
VPPSPEPPMLAPVAKSQLPTAKPLDAKSFTPKTKTKSSSPGQKTKSPKTAPSPAMVGSPI
HSPKTISKEKKSPGRSKSPKSPKSPKVMSHIPPAPVRPETPNRTPSITVSEKGSKEIIQV
KQIQTPPEAGKLNNENLPRKAVVMDKTIDDSIDAVIARACAEREPDPFEFSSGSESEGDI
FTSPKRISGSECITPKASTSSNNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKL
GTPANVPPNFPYLSSPSVSPPTPEPLPKVYEEKSKQPLSMEVKKKLKKELKTKMKKKEKQ
RDKEREREKSKEKSKDKERLKEREKEKEASKESKHPWKDFLKDEETDPYKFKIKEFDDVD
AKVRLKDGLVRREKEKHKDKKKDREKGKKDKDRRDKEKVKDRGREEKMRVPPAPLVLPPK
EMALPLFSPAGAMRVPSMLPSLSPMLPEKLFEEKEKPKEKERKKDRKEKKKKKEKEKEKK
EKEREKEKREREKREKEKEKHKHEKIKVEPVVPAPSPVIPRLTLRVGAGQDKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPALLPSVSPAISGAG
SRAPVRSVITETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGITA
APPEEMQWFCPKCANKKKDKKHKKRKHRAH
Download sequence
Identical sequences ENSEEUP00000002731 ENSEEUP00000002731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]