SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002743 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000002743
Domain Number - Region: 69-87
Classification Level Classification E-value
Superfamily HMG-box 0.00796
Family HMG-box 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002743   Gene: ENSEEUG00000002984   Transcript: ENSEEUT00000002989
Sequence length 104
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8377:40929:64177:-1 gene:ENSEEUG00000002984 transcript:ENSEEUT00000002989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFNYQSRLGTPACLLLLQHILRELSRLPEPRGKGCSSRMCTRQSSHLREKHLPGLAGA
FHKHVLLISKWRGMSAKQKKQYKEQFDSEGTVPCQVLLTHGYIS
Download sequence
Identical sequences ENSEEUP00000002743 ENSEEUP00000002743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]