SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002835 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002835
Domain Number 1 Region: 39-599,634-727,797-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.59e-235
Family Motor proteins 0.00000000166
Further Details:      
 
Domain Number 2 Region: 2095-2185
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 3 Region: 1979-2094
Classification Level Classification E-value
Superfamily Second domain of FERM 1.28e-19
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 4 Region: 1244-1300
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000723
Family First domain of FERM 0.042
Further Details:      
 
Domain Number 5 Region: 1900-1987
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000165
Family First domain of FERM 0.095
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002835
Domain Number - Region: 1377-1433
Classification Level Classification E-value
Superfamily Second domain of FERM 0.023
Family Second domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002835   Gene: ENSEEUG00000003014   Transcript: ENSEEUT00000003088
Sequence length 2199
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4126:2473:69821:1 gene:ENSEEUG00000003014 transcript:ENSEEUT00000003088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHPTSVHG
VEDMIRLGDLNEAGILRNLLIRYRDHLIYXXXXXXXXXXXXXQLLSIYSSEHIRQYTNKK
IGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIE
QQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGARIEQYLLEKSRVCRQA
PDERNYHVFYCMLEGMSEDQKKKLGLGQATDYNYLAMGNCVTCEGREDSQEYASICSAMK
VLLFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDL
MNCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQEV
KSSRRSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVHHVFKLEQEEYDLESIDWLH
IEFTDNQDALDMIANKPMNIISLIDEESKFPRGTDSTMLNKLNSQHKPNSNYIPPKNNYD
TQFGINHFAGIVYYESKGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFDRHLCVRQLRYSGMMETIR
IRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQEDLQGTCQRMAEAVLGAHDDWQIGKTKI
FLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRTRGRIILFQARCRVFLVRRAFRHRLWAVLTVQAY
ARGMIARRLHRRLQAEYLRRLEVEKMRLAEEEKLRKEMSAKKAKEEAERKHQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLGKTYRREL
QALQGEAEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEELTKRLHDGESTVRGNSMREDRP
TSNEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKF
VKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGT
TKTLLADSATTAHELCSALADKISLKDRFGFSLYIALFDKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDDL
AELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRR
TDVQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVL
LELSFPEIMAVSSSRECCVSLLLGCSDAGGTSLMSAGPCSPCWSCRGAKLTAPSFTLATI
KGYEYTFTSSNSEDIRDLVVTFLEGLRKRSKYVVPLQDNPNPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALVTMTPDQRQDMV
RLLQLRPPELEARGKPYTLEEFPYDYFSPPPKHTLSRVMVSKARGKDRLWSHTREPLKQA
LLKKILGSEELSQEACMAFVDVLKYMGDYPSKRMRSINELTDQIFEGALKAEPLKDEVYV
QILKQLTDNHIRYSEERGWELLWLCTGLFPPSNVLLPHVQRFLQSRKHCPLALDCLQRLQ
RALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFEVESSTKAKDFCQNIAARL
LLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMK
KLWTTTVPGKDPMADSIFHYYQELKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSI
PKLLRELVPQDLIGQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFE
VKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVR
GSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGTRSSK
Download sequence
Identical sequences ENSEEUP00000002835 ENSEEUP00000002835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]