SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003142 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003142
Domain Number 1 Region: 86-138
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000144
Family HMG-box 0.00079
Further Details:      
 
Domain Number 2 Region: 9-69
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000126
Family HMG-box 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003142   Gene: ENSEEUG00000003461   Transcript: ENSEEUT00000003443
Sequence length 145
Comment pep:novel scaffold:HEDGEHOG:scaffold_345360:36506:36964:-1 gene:ENSEEUG00000003461 transcript:ENSEEUT00000003443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVLREAPKTKRISTFAFFLRMCKAEHEEKNPGGRMNLVKFSRKCSRRWRMLSEEEKNAFR
DLARAERERNDPQTRGHGSAGRRERDSAFSQFSSDFRPKVKADYPDITSGNMSQKLGEMW
SNLSNMEKRLYEDKAAAQLTMQYNM
Download sequence
Identical sequences ENSEEUP00000003142 ENSEEUP00000003142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]