SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003199 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003199
Domain Number 1 Region: 315-424
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003199   Gene: ENSEEUG00000003521   Transcript: ENSEEUT00000003510
Sequence length 630
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8296:732117:860068:-1 gene:ENSEEUG00000003521 transcript:ENSEEUT00000003510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLSSSQGVVLTAYHPSGKDQAVGGSHGPGGEEYTSSRRYGHCTMNQGISKTTERPLFD
RSSSQDSLDELSMEHYWTEVEDIKKANENRQDQEIVVVKEPDEGELEEEWLKEAGLSNLV
GESSGDPHESMVFLSTLTRMQAAAVQKRVETVSQTLRKKNKQYQIPDVRDIFAQQRESKE
VVPDGTESQSVRTNENKYQEKDDHAPSLAVGEKEMIPSEETPVPETDINLEVSFAEQAVN
QKEYYKDKPKTQSTDATLPNFRLPKDKTGTTRIGDLAPQDMKKVCYLALIELTALYDVLG
IELKQQKAVKIKTRDSGLFCVPLTVLLEQDQRKIPGTRIPLIFQKLISRIEEGGLETEGL
LRIPGAATRIKNLCQELEAKFYEGTFNWESVKQHDAASLLKLFIRELPQPLLSVEYLKAF
QTVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXADVPRGMIRVQAPHLSKVSMAIKLTEELKASD
VLAKFVSQESRVAQVLKKGDVFLYEIGGNI
Download sequence
Identical sequences ENSEEUP00000003199 ENSEEUP00000003199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]