SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003260 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003260
Domain Number 1 Region: 97-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000247
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 287-333
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000181
Family PWWP domain 0.0083
Further Details:      
 
Domain Number 3 Region: 221-282
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000000262
Family Bromodomain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003260   Gene: ENSEEUG00000003540   Transcript: ENSEEUT00000003578
Sequence length 1136
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1439:3480:137930:-1 gene:ENSEEUG00000003540 transcript:ENSEEUT00000003578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPQXXXXXXXXXXXXXXXXXXXXXXXXXPGSTERTAQKRKFPSPPHSSNGHSPQDTSTS
PIKKKKKPGLLNNNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQV
LCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKF
AIQKMKQPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKKKMYGCTEAFLADAKWI
LHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPL
VWAKLKGFPFWPAKALRDKDGQVDARFFGQHDXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSPASTKTGQAGSLSGSPKPFSPQASTPSTTKTDKTSTTGSILNLNL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINEISEDV
YTAVEHSDSEDSDKSDSSDSEYISDDEQKSKNEPDVEDGGSQMDKSAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGKAPPSATAGNQSPPETPVLT
RSSSQTPTAGVTATTSTTSTVTAPAAATGSPVKKQRPLLPKETAPAVQRVVWNSSTVQQK
EITQSPSTSTITLVTSTQPSSLVTSSGSTSTLASSITADLPIATASADVAADIAKYTSKM
MDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXTLDLSGSRETPSSILLGSNQGSVSNRCDKQPAYTPTTTDHQPHPNYPAQK
Download sequence
Identical sequences ENSEEUP00000003260 ENSEEUP00000003260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]