SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003428 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003428
Domain Number 1 Region: 36-77
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000256
Family SAP domain 0.00015
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000451
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00055
Further Details:      
 
Domain Number 3 Region: 185-222
Classification Level Classification E-value
Superfamily SAP domain 0.0000275
Family SAP domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003428   Gene: ENSEEUG00000003759   Transcript: ENSEEUT00000003761
Sequence length 294
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8990:37449:50673:-1 gene:ENSEEUG00000003759 transcript:ENSEEUT00000003761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDIST
EMCREKEELVLLVLGQQPQEGRTHTTTLSPDFSEQQSFLTQPHTSTVPSTSPNLPSSPTQ
ATSVPPAQAQENQQANGHVSQDPEEPICLESTARAPAEDETQSIDSEDSFIPGRRASLSD
LTDLEDIENLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLXXXXXXXX
XGAVPPILEELCRICMDSPIDCVLLECHMVTCTKCKRMNECPCQYVIRAVHVRS
Download sequence
Identical sequences ENSEEUP00000003428 ENSEEUP00000003428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]