SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003686 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003686
Domain Number 1 Region: 1269-1484
Classification Level Classification E-value
Superfamily VPS9 domain 4.45e-53
Family VPS9 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 95-467
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.67e-38
Family p120GAP domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003686   Gene: ENSEEUG00000004002   Transcript: ENSEEUT00000004052
Sequence length 1487
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6335:583:116709:1 gene:ENSEEUG00000004002 transcript:ENSEEUT00000004052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLII
TSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKL
NQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSI
LFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGS
DRFRQKVQEMVDSNEAKLVALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVG
EVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSCVAAFLDVVIGGRAVETPPMSSVNLLEGLSRTVVYITYSQLITLVNF
MKSVMSGDQLREDRMALDNLLSNLPQAKPGKSSSLEMTPYNTPQLSPATTPANKKHRLPI
ATRSRSRTNVLMDLHMDHEGSFQETIQEVQPEEVLVISLGTGPQLTPGMMSENEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXAAAESMLGSLLCLPGPGSVLLDPCTGSTISETTSEAWSVEVL
PSDSEAPDLKQEERLQELESCSGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPN
KIEDLRSECSSDFGGKDSVTSPDMDEVAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHQ
LTSPPSQSESLLAMFDPLSSHEGASAVVRPKVHYARPSHPPPDPPILEGTVGGNEARLPN
FGSHVLTPAEMEAFKQRHSYPERLVRSRSSDIVSSVRRPMSDPSWNRRPGNEDRELPPTA
AIGATSLMATPHSSSSSPSKDSSRGETEERKDSDDEKSDRNRPWWRKRFVSAMPKAPIPF
RKKEKQEKDKDDLGPDRFSTLTDDPSPRLSAQTQVVEDILDKYRNAIKRTSPSEGAMANY
ESTEVMGDGESAHDSPRDETLQNISADDLPDSASQAAHPQDSAFSYRDAKKKLRLALCSA
DSVAFPVLAHSTRNGLPDHTDPEDNEIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRF
DNRTCRKLLASIAEDYRKRAPYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTT
VCVRLLLESKEHKIREFIQDFQKLTAADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQ
DAQLAIERSVMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLRE
APWPSAQSEIRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLI
KANPPCLLSTVQYISSFYASCLSGEESYWWMQFTAAVEFIKTIDDRK
Download sequence
Identical sequences ENSEEUP00000003686 ENSEEUP00000003686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]