SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003717 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003717
Domain Number 1 Region: 358-450
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 36-101
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000228
Family p120GAP domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003717
Domain Number - Region: 270-314
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00902
Family p120GAP domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003717   Gene: ENSEEUG00000004082   Transcript: ENSEEUT00000004089
Sequence length 451
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7975:572:7969:-1 gene:ENSEEUG00000004082 transcript:ENSEEUT00000004089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFLQPRDNGSKTLNSGDLGSLRLNVVYTEDHVFASDRYQPLRDLLLTSADVEPVSASAAH
ILGEVCREKQEAAVPLVRLLLHYGRVVPFISAVASAEVGRTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXASFKESYMATFYDFFNEQKYADAVKNFLDLIS
SSGRRDPKSMEQPILLKEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPPLY
SIPIENILAVEKLQEESFKMKNMFQVVQPERALYIQANNCVEAKAWTDVLTKVSQCNQRR
LSVYHPSAYLGGHWLCCRAPSDTAPGCTPCT
Download sequence
Identical sequences ENSEEUP00000003717 ENSEEUP00000003717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]