SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003759 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003759
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000101
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003759   Gene: ENSEEUG00000004139   Transcript: ENSEEUT00000004137
Sequence length 182
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1410:838:1947:1 gene:ENSEEUG00000004139 transcript:ENSEEUT00000004137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRCMHCDAKFDFLTRKHHCRRCGXXXXXXXXXXXXXLRRMCFVDLVRQCGRCALVSLRE
AEFFDRQLRVLLAGATFLVTFGDSGKSEAMVCRLSPNQRFLLLDGDSHHEVEVAHISAVQ
VLTEGFPPGGGNARATGMTLQGPRTRLQLTAGEDSSSNRRQATAWLVAMHKATKLLYESR
DQ
Download sequence
Identical sequences ENSEEUP00000003759 ENSEEUP00000003759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]