SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003769 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000003769
Domain Number - Region: 543-600
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00604
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003769   Gene: ENSEEUG00000004123   Transcript: ENSEEUT00000004147
Sequence length 721
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8733:31602:102831:1 gene:ENSEEUG00000004123 transcript:ENSEEUT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGWGAMARAGGSAGAWGAGGAGVAEPGELSLEAVLKAYEQPINEEQAWAVCFQGCGGLR
GAPGTGRIRDTADLLLRGDGSVSARGLGGSGEPTTMVVSPASWEAQMVQSLGFAIYRALD
WGLDESEERELSPQLERLIDLMANNDCEDSGADEGYGGPEEEEEAEGGPRAVRTFAQAMH
LCAARLTDPRGAQTHYQAVCRALFVETLELQAFLARIHEAKEMLQKLREDEPQSEKPLAE
LDHLGHTDWTRLWVQLMRELRHGVKLKKVQEQEFNPLPTEFQLTPFEMLMQDIRARNYKL
RKVMVEGDLPSQVKKDAHELILDFIRSPPLKQVSERRLRPLPQKQRTLHEKILEEIKQER
RLRPVGGEHWRGQGFGSLPCIPDACSGDLKSTSCINLSVTDGGSSTQRPRPRILLKAPTL
AEMEEMNTSEEEESPCGEVTLKRDRSFSEHDLAQLRSEMTSGLQSAFHHDLESSRPRASS
AHTWRPSTQEQGPLPVSVQSRLDPSSLPCSNQSAVKDRSEASPAPDANHRWLEFSHPVES
LALTVEEVIDVRRVLVKAEMEKFLQNKELVSSLKKGKICCCCRTKFPLFSWPSTCLFCKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLQGPQWQSVEE
AFPHIYTHGCVLKDVCSDCTSFVADVVRSSRKSVDALNSTPRRTRQTQSLYVPSTWTLDF
K
Download sequence
Identical sequences ENSEEUP00000003769 ENSEEUP00000003769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]