SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004064 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004064
Domain Number 1 Region: 89-172
Classification Level Classification E-value
Superfamily HMG-box 8.12e-26
Family HMG-box 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004064   Gene: ENSEEUG00000004472   Transcript: ENSEEUT00000004464
Sequence length 347
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4410:19809:66453:1 gene:ENSEEUG00000004472 transcript:ENSEEUT00000004464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLMTSSTLPPLFVDEDGSKESNDLATSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQ
LRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFN
RKTQDRQKGKSHRQDAARQAAHEHEKEAEVKERSVFDIPIFTEEFLNHSKAREAELRQLR
KSNMEFEERNAALQKHVESMRTAVEKLEVDVIQERSRNTVLQQHLETLRQVLTSSFASMP
LPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
Download sequence
Identical sequences ENSEEUP00000004064 ENSEEUP00000004064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]