SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004157 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004157
Domain Number 1 Region: 99-312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-54
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 456-522
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.27e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 549-643
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-18
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 296-380
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-16
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004157   Gene: ENSEEUG00000004550   Transcript: ENSEEUT00000004566
Sequence length 658
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5078:8697:37291:1 gene:ENSEEUG00000004550 transcript:ENSEEUT00000004566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGLSQASVSSLVTVFKNSRNPEARPRAHRLEVEHHTLGCQSTAESWKNSGTGEDLVSG
PRKVSRRYLSSLKNKLSGQAWRTPCQPDTSPGPTPQEPEKRIVQELLETEQAYVARLHLL
DQATSDMPLLQVFFQELLREARSGKAFPEDVVRLIFSNISSIYQFHAQFFLPELQRRLDD
WIATPRIGDVIQKLAPFLKMYSEYVKNFDRAIELLATWTDKSPPFQEVVTRIQSSEASGS
LTLQHHMLEPVQRIPRYELLLKEYLQKLPAEAPDRADAQKALDVIFSAAQHSNAAITEME
RLQELWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLFLFNNMLLYCVPRV
IQVGAHFQVRTRIDVAGMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXNESFKAAVQLEGDSEQELQCEELGLRAPLWIRDKMVTMCMRCQDPFNALTRR
RHHCRACGYVVCARCSDFRAELKYDDNRPNRVCFDCYTFLTGNVLPEDKDDKKRGILEKG
SAAGSEQNLMCSFLQLVGDKWGKNGPRGWCAIPRDDPLVLYVYAAPQDMRAHTSIPLLGY
QVTAGPQGDPRLFQLQQSGQLYSFRAETEELKGRWVKAMERAASGWSPGEPSDGDLSD
Download sequence
Identical sequences ENSEEUP00000004157 ENSEEUP00000004157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]