SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004197 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004197
Domain Number 1 Region: 241-328
Classification Level Classification E-value
Superfamily HMG-box 2.36e-24
Family HMG-box 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004197   Gene: ENSEEUG00000004619   Transcript: ENSEEUT00000004610
Sequence length 503
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3127:30722:112487:1 gene:ENSEEUG00000004619 transcript:ENSEEUT00000004610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQNRTEAVAGAFSHCLGFCGMRLGLFLFARRWCIAGVSLQKFDGDSAYVGMSDGNPELL
STSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXIQEMIHSEVAAYDSGRPGPLLSRPAMLASHMSAL
SQSQLISQMGIRSSIAHSSPSPPGSKSATPSPSSSTQEEESEAHFKISGEKRPSADPGKK
AKNPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQ
KQAYKRKTEAAKKEYLKALAAYRASLVSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFPLSPPLHQQLPLPPH
AQGALLSPPVSMSPAPQPPVLPAAMALQVQLAMSPSPPGPQDFPHLSEFPSGSGSRSPGP
ATATSSGDWDSSYPSGECGVSTC
Download sequence
Identical sequences ENSEEUP00000004197 ENSEEUP00000004197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]