SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004227 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004227
Domain Number 1 Region: 35-392
Classification Level Classification E-value
Superfamily Sema domain 1.57e-101
Family Sema domain 0.000000199
Further Details:      
 
Domain Number 2 Region: 573-655
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000444
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004227   Gene: ENSEEUG00000004640   Transcript: ENSEEUT00000004642
Sequence length 827
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1239:1106:16304:1 gene:ENSEEUG00000004640 transcript:ENSEEUT00000004642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWPLLLSFLTATAVPGPSLRRPSRELDATPRMTISYEELSGTRHFKGQAQNYSTLL
LEEASARLLVGARGALFSLNAHDIGDGTHKEXXXXXXXXXXXXXXXXXXXXXTECFNHVR
FLQRLNATHLYACGTHAFQPLCAAIDAEAFTLPASFEEGKEKCPYDPARGFTGLIIDGGL
YTATQYEFRSIPDIRRSRHPHSLRTEEAPMHWLNDAEFVFSVLVRESKASAVGDDDKVYY
FFTERAAEEGSSSFPQSRNSHRVARVARVCKGDLGGKKILQKKWTSFLKARLFCHIPQYE
ILRDVCSLDADASAHTHFYAVFTLTTQWSTLEASAICRYDLAEVQAVFTGPYMEYQDGAR
RWGRYEGGVPEPRPGSCITDSLRSRGYNSSQDXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTALIQDIERGNRGCEGYRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LFNGSVGLRDGQDGYRVGVDGLLVTDTQPEHSGNYSCYAEENSLRTLVALYSLKVRQVTP
APAPQAPAIPGAQLAPDVRLLYVLAIAALGGLCLILASSLLYVACLRGVRGGGRRRKYSL
GRAARAGGSAVQLQTVSGQCPGEEDDGDDGEGAGGLEGGCLQIIPGEGAPAPPPPPPPPP
PTELTNGLVALPSRLLQMMGNSYLLLRSNNGVPAGPCSFAEELSRIL
Download sequence
Identical sequences ENSEEUP00000004227 ENSEEUP00000004227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]