SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004233 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004233
Domain Number 1 Region: 846-987
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.13e-47
Family N-acetyl transferase, NAT 0.00000149
Further Details:      
 
Domain Number 2 Region: 719-792
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.83e-21
Family N-acetyl transferase, NAT 0.0000174
Further Details:      
 
Domain Number 3 Region: 256-309
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000244
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 101-180
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000392
Family Linker histone H1/H5 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004233
Domain Number - Region: 202-270
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000465
Family PHD domain 0.018
Further Details:      
 
Domain Number - Region: 1069-1096
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004233   Gene: ENSEEUG00000004613   Transcript: ENSEEUT00000004650
Sequence length 2029
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5565:16754:128491:1 gene:ENSEEUG00000004613 transcript:ENSEEUT00000004650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKASRVSCNDLHNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQNDLTGTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGPPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXTKFFTPSPGGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPLTPISGQSPSSQKSSTSTSSTSPQSSSSQSSVPSFSNLTNHSQL
KSLFDGLSHIYTTQGQSRKKGNPSYAPPKRMRRKTALSSSAKSKAHFFGKRDIRSRFITH
SSSSSWGMARGRIFKAIAHFKRTTFFKKHRMLDRLKYKVTPQMGTLSPGKGSLTDGRIKP
DQNDDTEIKISIKQENTDLNVIGNKDTITEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYLKSKNILLRHANKCGWFHPPANE
IYRRKDLSVFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRGGRFVIIRR
EKLILAHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSCRTNSRQSPAKVQSKKKYLHSPESRPMVGERRQIELSKDSSEEEEEEEEEEED
EEEEEDEEEEEEEEEENIQSSPPRLTKPQSVTIKRKRPFVLKKKRGRKRRRINSSVTTET
ISETTEVLNEPFDNSDEERPMPQLEPTCEIEIEEGGRKPVLRKAFQHQPGKKRQTEEEEG
KDNHCFKNADSCRNNMNDDADHLKEDSRDNPEPLKCKQIWPKGTKRSLSKWRPNKERKTG
FKLNLYTPPETPMEPDDEVAVEERKETPEDKTHPTPSPDXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSPDQSAISVPSQNMETSPMMVPSVSDHQQVVDSGFSDLGSIESTTENYENPSSYDS
TMGGSICGNNSSQNSCSYSNLTSSNLTQSSCAVTQQMSNISGSCSMLQQTNINSPPTCSV
KSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNASLGLYERMGQSDFGAGHY
PQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSV
PGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTASNIGISHSQRLQTQIASKGHVSMRTK
SASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNT
LNAMNGYSMSQPMMNSGYHSNHGYMQTAQYPMQMQMGMMTQPYAQQPMQ
Download sequence
Identical sequences ENSEEUP00000004233 ENSEEUP00000004233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]