SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004249 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004249
Domain Number 1 Region: 466-567
Classification Level Classification E-value
Superfamily Bromodomain 5.76e-31
Family Bromodomain 0.00033
Further Details:      
 
Domain Number 2 Region: 947-1066
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.38e-19
Family PWWP domain 0.016
Further Details:      
 
Domain Number 3 Region: 76-148
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.2e-17
Family PHD domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004249
Domain Number - Region: 186-225
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000487
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004249   Gene: ENSEEUG00000004664   Transcript: ENSEEUT00000004667
Sequence length 1082
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1255:8467:70345:1 gene:ENSEEUG00000004664 transcript:ENSEEUT00000004667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVSADTFELLVD
RLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYI
PEGQWLCRCCLQSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVCFANTVFLEP
IEGINNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFMKIEPMRETS
LNGTTFTVRKTAYCDAHSPPGAVTARRKGDSPGKLSEAGEEEGLKENCGENEEKEEMEEE
EEGDEDEGQGGVGGCLKGVPKKNKMTLKQKIKKEPEEAGRDISSTVPVVTVPQIPSYRLN
KICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNADQREQDEKTSAV
KEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRTTLDLL
QEKDPAHIFAEPVNLSEARVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNLIVT
NCMKYNAKDTIFHRAAVRLRDLGGAILRHARLQAEIGYDPEKGTHLPDSPNLGDLVLSLG
NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSRLPPPPTLEPTGPAP
SLSEQESPPDPPTLKPINDSKPPNRFLKPRKLEEDELLENSPLQLGNEPLQCLLSDNGID
RLSPMAPDASDIADAPLSDVGRRTSVLFKKAKNGAKLPRSPDRALENGKDHGAEDSPASP
TGIEDERHHRKRPRSRSCSESEGERSPEQAEETXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSLLMPFEDRGDLEPLELVWAK
CRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQRQAEAGEKLFLVLFFDNKR
TWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFVTSS
YL
Download sequence
Identical sequences ENSEEUP00000004249 ENSEEUP00000004249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]