SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004400 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004400
Domain Number 1 Region: 1355-1510
Classification Level Classification E-value
Superfamily Bet v1-like 3.16e-43
Family STAR domain 0.00000127
Further Details:      
 
Domain Number 2 Region: 447-514
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.93e-33
Family Variant SAM domain 0.0000388
Further Details:      
 
Domain Number 3 Region: 1174-1234
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000135
Family BCR-homology GTPase activation domain (BH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004400   Gene: ENSEEUG00000004790   Transcript: ENSEEUT00000004826
Sequence length 1523
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6273:2696:72671:-1 gene:ENSEEUG00000004790 transcript:ENSEEUT00000004826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAIRKRSWEEHVTQWMGQPFNSDYNTACHHGLVVDSLQASMEKDATVNVDRKEKCVSL
PDCCHGSDVRDFPGRSMGHISPVVDENDRHESEDQFLPLEASTETLVHVSDEDANSDLYP
TDDKQILTTQGYKTSDQHSVEGAGSLVDTFHIMESNQDSYKAWGISGGVELALIEERGER
KVVDILSESLEFCNDISLSELKDASTLNDCNSLNVKDTVPEKQLVNSAVIAQQRRKSDIT
KDDQERHTCNIVQDEILASPCTDRKLSLLKADSGHCLLQPSSCPSGMSAENGLEKSGFSE
YQNKSLQKVKSGDGMQCLHLKEFLATQEPMDNQVRLRKRKEIKEDRDRARLDSMVLLIMK
LDQLDQDIENALSTSSSPSSTPTNLRRQVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXTIPGISEKEQAEIEAKEACDWLRATGFPQYAQLYEDLLFPIDI
SLVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRXXXXXXDEPCISGKWTFQR
DRGWSRLEEFDVFFSKQDPVPGSPDDPHLQNATSHESMLTDLSEHQEVASVRSLSSTSSL
PAHVPHGGESTTLRTNSVISVCSSNNFVSNDDSFCSLPSPKELSSFSFSMKGQEKNTKSK
TRSLLKRMESLKLRGSHHGKHKAPSKLGLIISGPILQEGMDEEKLKQLNCVEISSLNGNH
INVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFDPFN
QSTFNNIAEQNFKNRGNYPEDTVFYIPEDHKPGTFPKALSNGSFSTSGNNSSVNWRTGSF
HGPGHVSLRRENSGSPKELKRRNSSSSMSSRLSIYDNVPGSLLYSSSGDLADLENEDIFP
ELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRATPSDL
DSTGNSLNEPEEPSDIPERRDSGVGASLTRSNXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPKDQRLQAIKAAIMLLPDENREVLQTL
LYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEGPPLRLWRATIEVSAMPEEILKR
LLKEQHLWDVDLLDSKVIEILDSTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALL
LTSVDHDRAPVVGVRVNVLLSRYLIEPCGSGKSKLTYMCRADLRGHMPEWYTKSFGHLCA
AEVVKIRDSFSNQNTETKDTRSR
Download sequence
Identical sequences ENSEEUP00000004400 ENSEEUP00000004400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]