SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004410 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004410
Domain Number 1 Region: 359-445
Classification Level Classification E-value
Superfamily SAND domain-like 4.01e-29
Family SAND domain 0.000033
Further Details:      
 
Domain Number 2 Region: 445-509
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000221
Family PHD domain 0.019
Further Details:      
 
Domain Number 3 Region: 530-631
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000301
Family Bromodomain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004410   Gene: ENSEEUG00000004778   Transcript: ENSEEUT00000004837
Sequence length 640
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_599:7502:66148:1 gene:ENSEEUG00000004778 transcript:ENSEEUT00000004837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTSPVHGLLEHLSHTKQTTAKRKCTASDKNDALGRQQANQHCAPEPEPEPEPAVVFRQVG
TQVDPGDTKRNEPSLLSYEEESPTAELLSHGFQVNSCSVTLVDIKKEPSWSPNVAGKAQA
RINNNQLSDVIVISSDSDDEHQCPKTSSSIPKSTSVNSSETYAGREIQETTCSGPQSTNL
KKPSPSWKKRIMDTPDSTDSSENETAEARKVVLRSDSEEDDSMDTNKYNGRAFSSDDSCK
MTLCEDLPQTSSTGLRRGSGAEYPGSGNETCSCVMCFSKGEPRGQEERAESSQASDLMDT
RVIEGYSVXXXXXXXXXXXXXXXXXXXXXXXXRRKVPHNRDHSQKRDKSRGPRIPKDKNM
NFQQPELPVTCGKVKGTLYKEKMKQGTLAKCILSENGQWLTLREFEVKGERGTWKNWKLS
LRCGGWTLKALIEQKHLPEPPSKRKKTTPTSQKSTSNDPYPKNSNTCKVCRGWGKLYCCD
TCSNSFHARCHIRRINPKSNPWSCLLCLLTEAQQKFPDKQCHKEAEVLKRPMKHVDKLKC
EVLLLKIFCYTKSRPLFIEKPHYIWNHRRFMCLNKVKKKLYGNKYFQVKMFVWDMRLITK
NHKTHYQGSKFATLDSQLETEFEKNFKRIFDILNKKSHIE
Download sequence
Identical sequences ENSEEUP00000004410 ENSEEUP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]