SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004560 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000004560
Domain Number - Region: 276-328
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00227
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004560   Gene: ENSEEUG00000005002   Transcript: ENSEEUT00000004996
Sequence length 360
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5558:16089:65400:1 gene:ENSEEUG00000005002 transcript:ENSEEUT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDIQKEIKRGTKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDLEETFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDTR
STSSHGTDEMESSSYRDRSPHRSSPSDARPKCGFCHVGEEENEARGKLHIFNAKKAAAHY
KCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKT
YHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKTATDQQQLNGN
Download sequence
Identical sequences ENSEEUP00000004560 ENSEEUP00000004560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]