SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004602 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000004602
Domain Number - Region: 154-190
Classification Level Classification E-value
Superfamily HMG-box 0.00405
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004602   Gene: ENSEEUG00000005055   Transcript: ENSEEUT00000005038
Sequence length 190
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8146:6128:8900:1 gene:ENSEEUG00000005055 transcript:ENSEEUT00000005038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSSPSPRRPSARFPHQRRKKRREMDDGRPEGGTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPSPLQPETQGTPDEEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESM
KILREMYERQ
Download sequence
Identical sequences ENSEEUP00000004602 ENSEEUP00000004602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]