SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004615 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004615
Domain Number 1 Region: 293-471
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00000138
Further Details:      
 
Domain Number 2 Region: 4-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000392
Family BAR domain 0.023
Further Details:      
 
Domain Number 3 Region: 659-681
Classification Level Classification E-value
Superfamily SH3-domain 0.00000544
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004615   Gene: ENSEEUG00000005023   Transcript: ENSEEUT00000005052
Sequence length 682
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_694:13446:167302:1 gene:ENSEEUG00000005023 transcript:ENSEEUT00000005052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLSFFQGMFTFYHQGHELAKDFNHY
KMELQINIQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPGVSLTMQAFSEEERRQWLEVLGGKEALYQSFNRAIIPRPEGNAQLDKMGFTVLRKCIS
AVETRGINDQGLYRVVGVSSKVQRLLSMLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNREMLDILVQHLTNVSNHC
KQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTLPAATFPE
PAVLSTSPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSQARSSMVQWLNPQSPSTPSCSPAVTP
PSPSTPPFPLSLPASVAEKPPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTSREP
GWLEGTLNGKRGLIPQNYVKLL
Download sequence
Identical sequences ENSEEUP00000004615 ENSEEUP00000004615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]