SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004702 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004702
Domain Number 1 Region: 626-910
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.99e-41
Family C5 cytosine-specific DNA methylase, DCM 0.0063
Further Details:      
 
Domain Number 2 Region: 283-338
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.31e-17
Family PWWP domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004702
Domain Number - Region: 529-596
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000345
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004702   Gene: ENSEEUG00000005098   Transcript: ENSEEUT00000005154
Sequence length 912
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2855:4782:30039:-1 gene:ENSEEUG00000005098 transcript:ENSEEUT00000005154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAMPSSGPGDTSSSAPEREEDRKEGEEQEEVRSKEERQEPSTMARKVGRPGRKRKHPPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEKKAKVIAVMNAVEESQGSSEPQK
VEESPAMQQPTDPASPTVATTPEPVSADAEDKNATKSADDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTIC
CGGRELLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRDD
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRY
IASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPAR
KGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMI
DAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSI
KQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLKEYFACV
Download sequence
Identical sequences ENSEEUP00000004702 ENSEEUP00000004702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]