SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004806 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004806
Domain Number 1 Region: 964-1084
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-24
Family Bromodomain 0.00052
Further Details:      
 
Domain Number 2 Region: 271-332
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 879-921
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000377
Family PHD domain 0.012
Further Details:      
 
Domain Number 4 Region: 126-156
Classification Level Classification E-value
Superfamily RING/U-box 0.0000022
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004806   Gene: ENSEEUG00000005249   Transcript: ENSEEUT00000005277
Sequence length 1129
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8379:6575:169142:-1 gene:ENSEEUG00000005249 transcript:ENSEEUT00000005277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENKGGGEAESGGGGTGSAPGTAGAAGPAAQEAEPPLAAVLVEEEEEEEEGGRAGAESG
AAGPDDGGVAAASSSSAPTASTPAATVGPGVAGGAVSTPAPAAASAPAPGPSAGPPPGPP
ASLLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDVQQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXETPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLC
KTCIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLYCETCDRLTCRD
CQLLEHKEHRYQFLEEAFQNQKGIIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRV
EQEIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNW
AIASGSSTALLYSKRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLVI
ESKPAPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQ
PPAPVPTTTATTQQHSRQAAPQMLQQQPPRLISVQTMQRSNMSCGAFQAHQMRLAQNAAR
IPGIPRHSGPQYSMMQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPT
SPSVTAIELIPPVTNPENLPSLPDIPPIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGSSGRNVEKTSLSFKADQVKVKQE
PGTEDEICSFSGTVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALTSLENHV
KSEPTDMNESCKQSGLNSLVNGKSPIRSLMHRSARIGGDGNSKDDDPNEDWCAVCQNGGD
LLCCEKCPKVFHLTCHVPTLLSFPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHY
QIPDDFVADVRLIFKNCERFNEMMKVVQVYAETQEINLKADSEVAQAGKAVALYFEDKLT
EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
Download sequence
Identical sequences ENSEEUP00000004806 ENSEEUP00000004806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]