SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004847 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004847
Domain Number 1 Region: 1179-1514
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-82
Family p120GAP domain-like 0.0000000000277
Further Details:      
 
Domain Number 2 Region: 1917-1949,2165-2410,2576-2639
Classification Level Classification E-value
Superfamily ARM repeat 0.0000183
Family Clathrin adaptor core protein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004847   Gene: ENSEEUG00000005130   Transcript: ENSEEUT00000005325
Sequence length 2802
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8318:466:250966:1 gene:ENSEEUG00000005130 transcript:ENSEEUT00000005325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLY
LSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTCREGNQHAAELRNSASG
VLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELLQYINVDCAKLKRLLKETAFK
FKALKKIAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAEST
KRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKXXXXXXXXXXXXXHGGSRQLTESA
ACVLCKATIWEDSVILLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISP
HNNQHFKXXXXXXXXXXXXXXXXXXXXXXXXXSALDWWPKIDAVYCHSVELRNMFGETLH
KAVQGCGAHPAIRMTPSLTFKEKVTNLKFKEKPTDLETRSYKYLLLSMVKLIHADPKLLL
CYPRKQGAEPPGSSAEIINGLILITLSDLALAQDAMEALLVLHQLDSIDLWNPDAPVETF
WEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSTAGCSGTPPICRQAQTKLEVA
LYMFLWSPDTEAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMST
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAESLHK
TIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNSGLATYSPPMGPI
SERKGSMISVMSSDGNADTPVSKFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALY
PMLFNKLKNTISKFFDSQGQVLWTDTNQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETM
MLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMG
TSNQAADDDVKCLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFTLFM
NLLNDCSEVEDDSAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHK
DLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVV
PCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELTDSMQTLFRGNSLASKIMTFCFKV
YGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTRRHSESEENRLLQMTEKFFHAIISSSS
EFPPQLRSVCHCLYQXXXXXXXXXXXXXXXXXXXXXVVSQRFPQNSIGAVGSAMFLRFIN
PAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAA
RRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRP
FDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFK
TDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKL
AEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQ
SVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECDAIVQSIIXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIELKHLCLEYMTPWLSN
LVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFI
KTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMW
DDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCT
CSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERE
TFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCI
SKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQPLLNKESPLHKAL
FWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMD
HFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTCRICQTLITLVNKLRDWDNFVQTQSV
AYFAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYTFHHGDPGYRTLKENHPWSS
PKGSEGYLAATYPNVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKR
QEMESGITTPPKRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQA
LLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNL
LNPIHGIVQSVVYHEESPPQYQTSYLQXXXXXXXXXXXXXXXXQTQIPDYAELIVKFLDA
LIDTYLPGIDEETSEESLLTPTSPYPPAVQSQLSITANLNLSNSMTSLATSQHSPGIDKE
NVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Download sequence
Identical sequences ENSEEUP00000004847 ENSEEUP00000004847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]