SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004933 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004933
Domain Number 1 Region: 12-175
Classification Level Classification E-value
Superfamily Sema domain 4.05e-47
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1516-1588
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000212
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 245-294
Classification Level Classification E-value
Superfamily Sema domain 0.000000209
Family Sema domain 0.019
Further Details:      
 
Domain Number 4 Region: 734-780
Classification Level Classification E-value
Superfamily E set domains 0.000000297
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 5 Region: 922-1012
Classification Level Classification E-value
Superfamily E set domains 0.000000542
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004933
Domain Number - Region: 660-735
Classification Level Classification E-value
Superfamily E set domains 0.000467
Family Other IPT/TIG domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004933   Gene: ENSEEUG00000005315   Transcript: ENSEEUT00000005421
Sequence length 1668
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2468:3086:30470:1 gene:ENSEEUG00000005315 transcript:ENSEEUT00000005421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVR
LCVDDPKFYSYVEFPIGCQQAGVEYRLVQDAYLSRPGRALARQLGLAEGEDALFTVFAQG
QKNRVKPPKESVLCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILVDL
GSPRSRPALAYESVVAQEGSPILRDLVLSPDRRYLYAMTEKQVTRVPVESCVQYPSCELX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEGRVNVSE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
TGENLGLRFEDVRLGVRVGKVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDC
STHYRALSPKRFTFVTPTFYRVSPARGPLSGGTWIGIEGNHLNAGSDVAVSVGGRPCSFS
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXSCMVYNDTTMLCRAPSGDNPLRSPSELGDRPD
ELGFVMDDVRVLLALNATSFVYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNS
RLNYTVLIGSTPCALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGMLQVYSDSLLTLP
AIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQ
TDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTK
KHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLQLLADLIKNLEKHPKL
LLRRXXXXXXXXXXXXXXXXXXXXXXECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSL
SEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKLLDAXXXXXXXXXX
XXXXXXXXXWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAY
NISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREG
DRGSKMVSEIYLTRLLATKGTLQKFVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSE
HKLGKDSPSNKLLYAKDIPNYKSWVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXILTALEKDEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences ENSEEUP00000004933 ENSEEUP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]