SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005092 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005092
Domain Number 1 Region: 35-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000863
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 2 Region: 201-244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000111
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005092   Gene: ENSEEUG00000005604   Transcript: ENSEEUT00000005593
Sequence length 353
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4084:89:9102:1 gene:ENSEEUG00000005604 transcript:ENSEEUT00000005593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSAMSLSRQPLQLLLGWTFLVLLLLGQVSGTEHCSTPCPASCPVTPTCTPGAKVVRDHC
SCCLVCARQRGESCSEMHPCLESSGLFCDRSADPSNHTGICMAEEGENGVFAGVIYRSGV
TFPPNCQFLTCEGQACEVRFEEDVLMPGPECPAPRKIKVPGECCEKWICDLNGTSPDFFT
LPAYRSEVTVGVTVPDSGVNCIEQTTEWSACSKSCGMGISTRVTNKNQQCEMVKQTRLCM
VRPCGQEHNQPTEMKGKKCLRTTKSPKAIYLHFENCTSLNTYKPRFCGICNDGRCCTPHN
TRTMKVDFECSPGKVIQNSVMLIRTCTCHSNCPQNNDAFLQELKPKTSRGGMK
Download sequence
Identical sequences ENSEEUP00000005092 ENSEEUP00000005092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]