SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005131 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005131
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005131   Gene: ENSEEUG00000005584   Transcript: ENSEEUT00000005634
Sequence length 1732
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2907:45309:111391:-1 gene:ENSEEUG00000005584 transcript:ENSEEUT00000005634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLS
GVASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDA
VSAATDEERLIKIHDVIQQLPPPHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFSGKISAVIQEGAASLARPKSLL
VSSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAALQGKFHTIIEFPLERRRPQ
NKLKKSPVGSWRSFFNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRAEGTLRSAKSEES
LTSLHAVDGDSKLFRPRRPRSSSDALSASFNGDMLGNRCNSYDNLPHDNESEEEVGLLHI
PALMSPHSAEDVDLSPPDIGVASLDFDPMSFQSPPKAESECLEGASLLDSLGYSKDKPTS
KKDADAGGSQSQTPGSTASSEPASPLQEKLSPFFTLDLSPTEEKLSKPSSFTEKVVYAFS
PKIGRKLSKSPSMNISEPISVTLPTRVSEVIGTTSNVTVPNLSSPECIWTKTIEDSDVTN
RSPTQVVKMKVNESEAQEECESGVQTLDQVAAVEVESPGKEEQAGSCSQSKAVPSGQTQT
GAVTHDPPQDSVPVSSVSIIPPPPPPKNVARLLALALAESAQQASTQTLKRPGTSQAAYP
NNGNVAVIATEDKLPSSYPSVTLDKAYFQTDRPAEQFHLHNNASGICDQPVPDTAAIGGQ
SHPETAESGDQLHQADLPGNQPHRTFLSGDPEKNGITSVPLPDSKSDDHISFPEEKPGKT
NMPTVSFADQEPSQLHFYSDEDFPYLGASADKSPYPSEFTDKHVTPSTLPRDKTYPPSGS
HEENTSTAAMAYMTTAPAAAEISTREVNWDVAEQPHTADFAATATLQRPHRTNRPLPPPP
SQRSTEQLPTISSAVGLNNSHKVQAVVTVPERPPEPRAMDDPALVFLTDGSAASQCPASA
PAVQPDLPEKVREGSRAPPLHLRAESVPLYSSCGFTAPVPSTRTMESKIAAAIHSNSADA
ASASSYHPFIAASSASVDDVLPLPLPIPQPKHASQKPAYSTFARPDFTTEPFGPENCLHF
SMTPNCQFRPQSVPPHHNKLEQHQAYGSRSEPPASMGPRFNTYVAPGRTVSGHHTKPCNR
VEYVSSLSSSIRSTCYPEDIPPYPTIRRVQSLHAPPSTMIRSVPISRTEVPPDDEPAYCP
RPLYQYKPYQSSQARSDYHVTQLQPFFENGRVHYRYSPYSSSSSSYYSPEGTLYDVDTYG
TVQLRPLHRLPNRDFAFYNPRVQGKNLCNYVGVPPRPRANMTGYFSGDDHNIVNMRPAAD
GKHTYTSWDLGDMGKYRMQAVGEESRARQKVKGPVMSDNRTPAVQDDLGGIYVIHLRSKS
DPGKTGLLSVAEGKEGRHPVKAVSPEGDDRFYRKPPEPEFDRTHHHGGYGNGQSEKPSLP
QKQSSLRNRKLHDMGCSLPEHRAHQEASHRQLCESKNGPPYPQGAGQLDYGSKGIPDTSE
PVSYHNSGGKYVTSGQETLRLNHKEVRLSKELERPRARQPPAPEKHSRDCYKEEEHLAQS
VPPPKPERSHSLKLHHTQTVERDPSMLYQYQTHGKRQSSVAVVSQYDNLEGYHSPPQHQH
QRAGFGGGAVGTYMPSGFPHPQNRTYATALGQGAFLPTELALQHPETQIHAE
Download sequence
Identical sequences ENSEEUP00000005131 ENSEEUP00000005131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]