SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005150 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005150
Domain Number 1 Region: 205-371
Classification Level Classification E-value
Superfamily Sema domain 6.41e-41
Family Sema domain 0.00019
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Sema domain 0.00000000000000131
Family Sema domain 0.0026
Further Details:      
 
Domain Number 3 Region: 368-409
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000167
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 419-494
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000356
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005150   Gene: ENSEEUG00000005621   Transcript: ENSEEUT00000005656
Sequence length 539
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4266:864:9923:-1 gene:ENSEEUG00000005621 transcript:ENSEEUT00000005656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCENHITLLEPRGQGLLACGTNARRPSCWSLENGSVQALGEHRGYAPFSPEENALVLFDG
DEVYSTIRKQEYNGKIPRFRRIRGDGELYTSDTVMQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNYSAVCVYSLGDIDRVFRTSSLRGYSSGLPTPRPG
QCLPNRQPIPTETFQVADSHPEVAQRVEPVGPLKVPLLHSKYHYQKVAVHRTASYGHTFH
VLYLSTDRGTVHKVVEAVGHNHSSIFNVAEIQPFRRPAPIQTMNLDAKRRKLYLSSQWEV
SQLPLDLCEAYGGGCHGCLMARDPYCGWAQGRCTSIHRAPRAVLQSMDPEEPHQDCPNPK
PEKGTPQKVSPAQSSRYYLSCPMDSRHGTYSWRHGDNVEQSCGPRPPSASCVLFIENLTA
RQYGHYRCEAREGVHLREAQHWELLPEGGSAQHLRGACALPATLLLLLLPAPAPALGPL
Download sequence
Identical sequences ENSEEUP00000005150 ENSEEUP00000005150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]