SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005346 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005346
Domain Number 1 Region: 359-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 278-337
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000663
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005346
Domain Number - Region: 27-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005346   Gene: ENSEEUG00000005844   Transcript: ENSEEUT00000005867
Sequence length 631
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5832:51538:92999:-1 gene:ENSEEUG00000005844 transcript:ENSEEUT00000005867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTMLNLRNLFEQLVHQAEILSEGNELQFMQLAKNFEDFRKKWQRIDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLTCDTSGSIQLSEE
QKSALGFLNRGQPSNGNAGNKRLSTIDESGSILSDISFDKTDESLEWDSSLIKTFKLKKR
EKRRSSRQFTDGPPGPAKKTRSIGSTVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVPY
WTRSRRKGPGTLQPWNSDSTLSSRQLEPRPETDSSSTPQNNGGMRLHDFVSKTVIKPESC
VPCGKRIKFGKLSLKCRDCRVVSHPECRDRCPLPCIPTLTGTPVKIGEGMLADYVSHTAP
MIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKFLRVKTVPLLSKVDDVHAVCS
LLKDFLRNLKEPLLTFRLNKTFMEAAELTDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPDTKMDVANLAKVFGPTIVAHAVPNPDPVAMLQDIKRQPKVVERLLSLPLEYWS
QFMMVEQENIDPMHVIENTNAFSTPQTPDVKVGLLGPLSTPEHQLIKTPSSSSLSQRVRS
TLTKNTPKFGTKSKSATNLGQGKFFASPLLK
Download sequence
Identical sequences ENSEEUP00000005346 ENSEEUP00000005346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]