SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005390 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005390
Domain Number 1 Region: 52-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000187
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 318-364
Classification Level Classification E-value
Superfamily RING/U-box 0.000000127
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 260-297
Classification Level Classification E-value
Superfamily SAP domain 0.00000977
Family SAP domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005390   Gene: ENSEEUG00000005934   Transcript: ENSEEUT00000005913
Sequence length 370
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8957:41574:56043:1 gene:ENSEEUG00000005934 transcript:ENSEEUT00000005913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQAGATSMWASCCGLLNEVMGTGAVRGQQSGFAGGTGPFRFTPNSDFPTYPSAPTEGPN
IVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLK
VKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSMNSSRSQTSSFFTHSF
FSNYTAPTATFQGELMGGDRTLGSGALAQVQTEIASANTDDDDDDDDDDDDEDEEDLEEQ
KPGLSKNRVRASLSDLSSLEDIEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKE
NEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQY
VVRAVHVFKS
Download sequence
Identical sequences ENSEEUP00000005390 ENSEEUP00000005390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]