SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005525 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005525
Domain Number 1 Region: 309-476
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000458
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily PX domain 0.000000000563
Family PX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005525   Gene: ENSEEUG00000006002   Transcript: ENSEEUT00000006056
Sequence length 1285
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_36:694:11678:1 gene:ENSEEUG00000006002 transcript:ENSEEUT00000006056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARSTDSLDGPGEGSVQPLPPTGGPSVKGKSGKRLSAPRGPFPRLADCAHFHYENVDFGHI
QLLLSPEREGPSFSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDTHLHRCIFDRRFSCL
PELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGFFPSEC
VELFTERPSPGLKGDADGPLSGVSSAQGVSSLTSAVPRPRGKLAGLLRTFMRSRPSRQRL
RQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQRLR
HEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERL
VRVHDVIQQLPPPHYRTLEYLLRHLARMARHSATTSMHARNLAIVWAPNLLRXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRCLLPRPKSLVGSGPSTRL
LTLEEAQARTQGRLGTSTDPTASKATASPVDRRKGERGEKPRKTGGSSWKTFFALGRGPS
IPRKKPLPWLGGTRAPPHPSGSRPDTVTLRSAKSEESLSSQASGAVPRGLRLGSPHSGSD
AISLGPATAGSCESEASSSSSESTSSSKSSSSESSAAGLGALSASPSHRTSAWLDDGDEL
DFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRATPQALSPRGP
TSPASPAALDISEPLAVSVPPAVLELLGAGGMPASVTPTPALSPNPSPSLRPHLIPLLLC
GAETQLSDTCQQEICSKLALPGPRGVPGQQGPGVESPLRPPELCLLCPEGARAPHGEDAG
DLPVALPLLARVLQEHTRREASAHSESGSAVCRSLSLEVEPPGSAGSGLTLHSLAHPGAW
APGPPPSLPRQQSDGSLVRTPRPLGTSRRGFRGPTQASAQLRASRGFRGMLETAPQFPCP
VPSQVPTPGFFSSPPRECLPPFLGVSKPGLYSLGSPPFQPSSPAPVWRSPLGPPTPLDRG
ENLYYEIETGEGSPYSGPSRSWSPFHSMPPDRLNASYGMLGQSPPLHRSPDFLLSYPPPP
ACFPHDHLGYSTSQHSVQRPTRPEPLYVNLALGPRGPSPASSSSSSSPAHPRSRSDPGPP
APRLPQKQRAPWGPHTPHRVPGPWGPPEPLRLYRAAPPAYGRGGEHLRGSLYRNGGRGRE
GAGPPPPYPTPSWSLHSEGQTHSYC
Download sequence
Identical sequences ENSEEUP00000005525 ENSEEUP00000005525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]