SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005577 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005577
Domain Number 1 Region: 162-216
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000975
Family PHD domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005577   Gene: ENSEEUG00000006094   Transcript: ENSEEUT00000006111
Sequence length 259
Comment pep:novel scaffold:HEDGEHOG:scaffold_227289:1515:6866:-1 gene:ENSEEUG00000006094 transcript:ENSEEUT00000006111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVDWELPILLEALGFLPPKNDSAKNGLDSLGSISSYRXXXXDAEPPRVPSTKATAVK
QEPKVTPSLPSSSNNGKALSTEKTKKEVEKRPADKMKADSVEGADIPKKPRLEKPETRAS
PITVQTSKDLAMADLYSFEETSADFAMEXXXXXXXXXQMTVTSGNQLVECQECHNLYHQD
CHRPQVTDKEVNDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPAVVSVAPTVKDPLVKKP
ETKLKPETTFLAFKRTEVK
Download sequence
Identical sequences ENSEEUP00000005577 ENSEEUP00000005577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]